The domain within your query sequence starts at position 279 and ends at position 356; the E-value for the Pax2_C domain shown below is 5.7e-28.
ANLTSPTPADIGSSVPGPQSYPIVTGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYY SPAARGAAPPAAATAYDR
Pax2_C |
![]() |
---|
PFAM accession number: | PF12403 |
---|---|
Interpro abstract (IPR022130): | This domain is found in the C terminus of the paired-box protein 2, which is a transcription factor involved in embryonic development and organogenesis. It is approximately 110 amino acids in length and is found in association with . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pax2_C