The domain within your query sequence starts at position 30 and ends at position 95; the E-value for the Pellino domain shown below is 1.8e-24.
CPGEEALAGEEPIKYGELIVLGYNGCLASGDKGRRRSRLALSRRPHANGVKPDVMHHIST PLVSKI
Pellino |
![]() |
---|
PFAM accession number: | PF04710 |
---|---|
Interpro abstract (IPR006800): | Pellino proteins are E3 ubiquitin ligases that play an important role in immunity [ (PUBMED:26085209) (PUBMED:24445667) ]. Pellinos contain a CHC2CHC2 RING E3 ubiquitin ligase domain [ (PUBMED:16884718) ]. Mammalian Pellinos have been shown to mediate polyubiquitination of interleukin-1 receptor-associated kinase (IRAK) [ (PUBMED:16884718) (PUBMED:19022706) ]. |
GO process: | protein polyubiquitination (GO:0000209), regulation of Toll signaling pathway (GO:0008592) |
GO function: | ubiquitin protein ligase activity (GO:0061630) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pellino