The domain within your query sequence starts at position 8 and ends at position 418; the E-value for the Pellino domain shown below is 5.4e-227.

NHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAK
AISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDT
QSVQSTISRFACRIICERSPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNG
VLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLC
GATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWV
YLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPC
GHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

Pellino

Pellino
PFAM accession number:PF04710
Interpro abstract (IPR006800):

Pellino proteins are E3 ubiquitin ligases that play an important role in immunity [ (PUBMED:26085209) (PUBMED:24445667) ]. Pellinos contain a CHC2CHC2 RING E3 ubiquitin ligase domain [ (PUBMED:16884718) ]. Mammalian Pellinos have been shown to mediate polyubiquitination of interleukin-1 receptor-associated kinase (IRAK) [ (PUBMED:16884718) (PUBMED:19022706) ].

GO process:regulation of Toll signaling pathway (GO:0008592), protein polyubiquitination (GO:0000209)
GO function:ubiquitin protein ligase activity (GO:0061630)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pellino