The domain within your query sequence starts at position 291 and ends at position 435; the E-value for the Pep3_Vps18 domain shown below is 2.4e-41.
GVLYGSLDCGRPDSLLSEERVWEYPAGVGPGANPPLAIVLTQFHFLLLLADRVEAVCTLT GQVVLRDHFLEKFGPLRHMVKDSSTGHLWAYTERAVFRYHVQREARDVWRTYLDMNRFDL AKEYCRERPDCLDTVLAREADFCFR
Pep3_Vps18 |
---|
PFAM accession number: | PF05131 |
---|---|
Interpro abstract (IPR007810): | This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting. The molecular function of this region is unknown. Proteins containing this domain also contain a C-terminal ring finger domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pep3_Vps18