The domain within your query sequence starts at position 46 and ends at position 163; the E-value for the Pep_M12B_propep domain shown below is 1.5e-19.

EIVIPRKVPQRMGKSDMSGHITYSMRFRGQRHVVHMKLKKNMIPQNFPVYTSNDQGAQQK
DYPFVPRDCYFYSYLEGVPGSQATLDTCTGGLKGMIQVDDFTYEIKPLASSSKFEHVI

Pep_M12B_propep

Pep_M12B_propep
PFAM accession number:PF01562
Interpro abstract (IPR002870):

This signature covers the region of the propeptide for members of the MEROPS peptidase family M12B (clan MA(M), adamalysin family). The propeptide contains a sequence motif similar to the "cysteine switch" of the matrixins, which mediate cell-cell or cell-matrix interactions.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pep_M12B_propep