The domain within your query sequence starts at position 90 and ends at position 319; the E-value for the Peptidase_C65 domain shown below is 4.4e-75.

QSETSFNLISEKCDILSILRDHPENRIYQRKIQELSKRFTSIRKTKGDGNCFYRALGYSY
LESLLGKSREILKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDSSVSSLLK
VFNDQSSSDRIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMAMECDHVQI
TALSQALNIALQVEYVDEMDTALNHHVFPEAAIPSVYLLYKTSHYNILYA

Peptidase_C65

Peptidase_C65
PFAM accession number:PF10275
Interpro abstract (IPR019400):

This family of proteins is a highly specific ubiquitin iso-peptidase that removes ubiquitin from proteins [ (PUBMED:12704427) ]. The modification of cellular proteins by ubiquitin (Ub) is an important event that underlies protein stability and function in eukaryotes, as it is a dynamic and reversible process. Otubain carries several key conserved domains: (i) the OTU (ovarian tumour domain) in which there is an active cysteine protease triad (ii) a nuclear localisation signal, (iii) a Ub interaction motif (UIM)-like motif phi-xx-A-xxxs-xx-Ac (where phi indicates an aromatic amino acid, x indicates any amino acid and Ac indicates an acidic amino acid), (iv) a Ub-associated (UBA)-like domain and (v) the LxxLL motif [ (PUBMED:1270442) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_C65