The domain within your query sequence starts at position 129 and ends at position 185; the E-value for the Peptidase_M15_3 domain shown below is 5.9e-8.
WDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVS
Peptidase_M15_3 |
---|
PFAM accession number: | PF08291 |
---|---|
Interpro abstract (IPR013230): | This entry represents the C-terminal domain of zinc D-Ala-D-Ala carboxypeptidases from Streptomyces species and non-peptidase homologues that belong to MEROPS peptidase family M15 (subfamily M15A, clan MD) [ (PUBMED:15044722) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M15_3