The domain within your query sequence starts at position 50 and ends at position 220; the E-value for the Peptidase_M76 domain shown below is 4.8e-60.
QSCPLMLQKTLDTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTSQIVLC ENNIRNQAHMGRVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSLVNELFR LRFGLKQHHQTCVRDRAVLSILAVRNVSREEAQKAVDEVFQTCFNDREPFG
Peptidase_M76 |
---|
PFAM accession number: | PF09768 |
---|---|
Interpro abstract (IPR019165): | Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [ (PUBMED:17135290) (PUBMED:17135288) ]. |
GO function: | metalloendopeptidase activity (GO:0004222) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M76