SMART: Pfam domain Peptidase_MA

The domain within your query sequence starts at position 321 and ends at position 465; the E-value for the Peptidase_MA_2 domain shown below is 1.2e-23.

NWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFAS
WIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYS
KGASVIRMLHDYIGDKDFKKGMNMY

Peptidase_MA_2

PFAM accession number:	PF13485
Interpro abstract (IPR039568):	This entry represents a group of putative peptidases belonging to the MA clan. Clan MA is one of two zinc-dependent metallopeptidases that contain the HEXXH motif. The two histidines are zinc ligands. The structures of this clan show the active site is between its two sub-domains.

PFAM accession number:

PF13485

Interpro abstract (IPR039568):

This entry represents a group of putative peptidases belonging to the MA clan.

Clan MA is one of two zinc-dependent metallopeptidases that contain the HEXXH motif. The two histidines are zinc ligands. The structures of this clan show the active site is between its two sub-domains.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_MA_2