The domain within your query sequence starts at position 321 and ends at position 465; the E-value for the Peptidase_MA_2 domain shown below is 7.4e-24.
NWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFAS WIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYS KGASVIRMLHDYIGDKDFKKGMNMY
Peptidase_MA_2 |
---|
PFAM accession number: | PF13485 |
---|---|
Interpro abstract (IPR039568): | This entry represents a group of putative peptidases belonging to the MA clan. Clan MA is one of two zinc-dependent metallopeptidases that contain the HEXXH motif. The two histidines are zinc ligands. The structures of this clan show the active site is between its two sub-domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_MA_2