The domain within your query sequence starts at position 617 and ends at position 793; the E-value for the Peptidase_S15 domain shown below is 2.8e-10.

DVQLYGMIYKPHTLQPGRKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVI
DGRGSCQRGLHFEGALKNQMGQVEIEDQVEGLQYVAEKYGFIDLSRVAIHGWSYGGFLSL
MGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQQGYEAGSVALHVEKLP

Peptidase_S15

• PFAM accession number: PF02129
• Interpro abstract (IPR000383):

  This entry represents a domain found in Xaa-Pro dipeptidyl-peptidases, which belong to MEROPS peptidase family S15 [ (PUBMED:7845208) ]. It is also found in hydrolases from the CocE/NonD family. Cocaine esterase (CocE) hydrolyses cocaine endowing the bacteria with the ability to utilise cocaine as a sole source of carbon and energy [ (PUBMED:10698749) ].

• GO function: hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_S15