The domain within your query sequence starts at position 144 and ends at position 371; the E-value for the Peripla_BP_6 domain shown below is 3e-11.
FVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDS FQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDR TIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPL HQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEEN
Peripla_BP_6 |
![]() |
---|
PFAM accession number: | PF13458 |
---|---|
Interpro abstract (IPR028081): | This domain is found in periplasmic binding proteins, mainly belonging to the leucine-binding and Leu/Ile/Val-binding proteins. The periplasmic leucine-binding protein is the primary receptor for the leucine transport system in Escherichia coli [ (PUBMED:14672931) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peripla_BP_6