The domain within your query sequence starts at position 101 and ends at position 256; the E-value for the Peroxin-13_N domain shown below is 3.6e-51.

GYNGLGFNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSF
RAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTV
ACLSAEDQATNSAKSWPIFLFFAVILGGPYLIWKLL

Peroxin-13_N

 Peroxin-13_N
PFAM accession number:PF04088
Interpro abstract (IPR007223):

Peroxin-13 is a component of the peroxisomal translocation machinery with Peroxin-14 and Peroxin-17. Both termini of Peroxin-13 are oriented to the cytosol. It is required for peroxisomal association of peroxin-14 [ (PUBMED:10882522) ]. The proteins also contain an SH3 domain ( IPR001452 ).

GO process:protein import into peroxisome matrix, docking (GO:0016560)
GO component:peroxisome (GO:0005777), integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peroxin-13_N