The domain within your query sequence starts at position 7 and ends at position 284; the E-value for the Pescadillo_N domain shown below is 1.1e-130.
KKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYL IKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNAVERLKDNKPCYKLDHIVKERYPT FIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYVITARALRKLPPQVF LSIKGIYYQAEVLGQPIVWIAPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQSL NLHYPPKLEGQAQAETKISEDTYALDSESSMEKLAALS
Pescadillo_N |
![]() |
---|
PFAM accession number: | PF06732 |
---|---|
Interpro abstract (IPR010613): | Pescadillo (PES) protein was first identified as an essential protein for zebrafish embryonic development [ (PUBMED:8985183) ]. It is conserved from yeasts to humans. Pescadillo homologues are involved in embryonic development and ribosome biogenesis [ (PUBMED:19075239) (PUBMED:17727835) ]. It has been linked to chromosomal instability and cancer [ (PUBMED:15467761) (PUBMED:22860098) ]. |
GO process: | ribosome biogenesis (GO:0042254) |
GO component: | nucleolus (GO:0005730) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pescadillo_N