The domain within your query sequence starts at position 1 and ends at position 137; the E-value for the Pex26 domain shown below is 2e-70.
MKSDASTSAAPLKGLVGPLRSSEPALALPAVSPAVHLLEEASDLLVVHLDFHAALETCER AWQSLAEEPVSGTIVEVKCSLCVVGIQALAEMDRWREALSWVLRYYQVPEKLPPKVLELW FVLPEVAVAADAASPAL
Pex26 |
---|
PFAM accession number: | PF07163 |
---|---|
Interpro abstract (IPR010797): | Pex26 is a type II peroxisomal membrane protein that recruits Pex6-Pex1 complexes to peroxisomes [ (PUBMED:12717447) ]. Mutations in the Pex26 gene cause peroxisome biogenesis disorder complementation group 8 (PBD-CG8) and peroxisome biogenesis disorder 7A/B (PBD7A/B) [ (PUBMED:12851857) ]. |
GO process: | protein import into peroxisome membrane (GO:0045046) |
GO component: | integral component of peroxisomal membrane (GO:0005779) |
GO function: | protein-containing complex binding (GO:0044877) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pex26