The domain within your query sequence starts at position 15 and ends at position 81; the E-value for the PhoLip_ATPase_N domain shown below is 1.3e-29.
RARANDREYNEKFQYASNCIKTSKYNIVTFLPVNLFEQFQEVANTYFLFLLILQLIPQIS SLSWFTT
PhoLip_ATPase_N |
---|
PFAM accession number: | PF16209 |
---|---|
Interpro abstract (IPR032631): | This domain is found at the N terminus of a number of phospholipid-translocating ATPases. It is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhoLip_ATPase_N