The domain within your query sequence starts at position 65 and ends at position 144; the E-value for the PhoLip_ATPase_N domain shown below is 5.3e-29.
QVKANDRKFHEQPHFMNTKFFCIKESKYASNAIKTYKYNGFTFLPMNLFEQFKRAANFYF LILLILQAIPQISTLAWYTT
PhoLip_ATPase_N |
 |
|---|
| PFAM accession number: | PF16209 |
|---|---|
| Interpro abstract (IPR032631): | This domain is found at the N terminus of a number of phospholipid-translocating ATPases. It is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhoLip_ATPase_N