The domain within your query sequence starts at position 29 and ends at position 88; the E-value for the Phospho_p8 domain shown below is 5.8e-27.
FEEEVYDCLDYYYLRDFPASGAGRSKGRTRREQQLRTNYPVPGGHERKVAQILLNGQRKR
Phospho_p8 |
---|
PFAM accession number: | PF10195 |
---|---|
Interpro abstract (IPR018792): | This entry represents a group of nuclear proteins that are conserved from nematodes to humans. They can form a helix-loop-helix motif and are related to, yet distinct from, the HMG-I/Y-like subfamily of HMG proteins. This entry includes two human nuclear proteins, NUPR1 (also known as p8) and NUPR2. Similar to several HMGs, NUPR1 binds DNA, however, it has a low affinity and poor sequence specificity for DNA binding [ (PUBMED:25056123) ]. NUPR1 is multifunctional protein that interacts with several partners to target different signalling pathways, such as the NUPR1/RELB/IER3 survival pathway [ (PUBMED:22565310) ] and the PI3K/AKT signaling pathway [ (PUBMED:22858377) ]. It also binds to and inhibits MSL1, a protein with 53BP1-dependent DNA-repair activity [ (PUBMED:19650074) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phospho_p8