The domain within your query sequence starts at position 109 and ends at position 330; the E-value for the Phosphodiest domain shown below is 3.7e-11.

VSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAQREDFGA
HDATKLDTWVFDKVKDFFDAARNNQSLFTKVNEEKVVFFLHLLGIDTNGHAHRPSSREYK
DNIKKVDDGVKEIVSIFKHFYGDDGKTAFIFTSDHGMTDWGSHGAGHPSETLTPFVTWGA
GIKFPQNVSAQQYDDEFLKEWRLENWKRRDVNQADIAPLMAS

Phosphodiest

Phosphodiest
PFAM accession number:PF01663
Interpro abstract (IPR002591):

This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase). These enzymes catalyse the cleavage of phosphodiester and phosphosulphate bonds in NAD, deoxynucleotides and nucleotide sugars [ (PUBMED:9344668) ]. Another member of this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity [ (PUBMED:7982964) ]. The alignment encompasses the active site [ (PUBMED:7730366) (PUBMED:7982964) ]. Also present within this family is 60kDa Ca 2+ -ATPase from Myroides odoratus [ (PUBMED:8617788) ].

This signature also hits a number of ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phosphodiest