The domain within your query sequence starts at position 6 and ends at position 135; the E-value for the Polysacc_synt_2 domain shown below is 1.2e-12.
CLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKAKVTALKGDILD AQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFIYSSS VLVAGPNSYK
Polysacc_synt_2 |
![]() |
---|
PFAM accession number: | PF02719 |
---|---|
Interpro abstract (IPR003869): | This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [ (PUBMED:7961465) ], the WalL protein, mannosyl-transferase [ (PUBMED:9079898) ], and several putative epimerases. The CapD protein is required for biosynthesis of type 1 capsular polysaccharide. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Polysacc_synt_2