SMART: Pfam domain Polysacc_synt

The domain within your query sequence starts at position 35 and ends at position 137; the E-value for the Polysacc_synt_4 domain shown below is 6.4e-22.

IEMAWAIRAMQHAEVYYKLISSVDPQFLKLTKVDDQIYSEFREIFETLRVDVLDPEELKS
ESAKEKWRPFCLKFEGIVEDYNYGTLLRLDCSQGYTEENTIFA

Polysacc_synt_4

PFAM accession number:	PF04669
Interpro abstract (IPR021148):	This domain can be found in IRX15/IRX15L/IGXM from plants and in protein PBDC1 from animals and fungi. IRX15/IRX15L and IGXM play a role in xylan biosynthesis in plant cell walls. However, they have different functions [ (PUBMED:24576763) ]. The function of IRX15/IRX15L is not clear. GXM1/GXM2/GXM3 are methyltransferases catalysing 4-O-methylation of GlcA side chains on xylan [ (PUBMED:23045523) (PUBMED:24576763) ]. The function of PBDC1 (polysaccharide biosynthesis domain-containing protein) is not clear.

PFAM accession number:

PF04669

Interpro abstract (IPR021148):

This domain can be found in IRX15/IRX15L/IGXM from plants and in protein PBDC1 from animals and fungi.

IRX15/IRX15L and IGXM play a role in xylan biosynthesis in plant cell walls. However, they have different functions [ (PUBMED:24576763) ]. The function of IRX15/IRX15L is not clear. GXM1/GXM2/GXM3 are methyltransferases catalysing 4-O-methylation of GlcA side chains on xylan [ (PUBMED:23045523) (PUBMED:24576763) ].

The function of PBDC1 (polysaccharide biosynthesis domain-containing protein) is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Polysacc_synt_4