The domain within your query sequence starts at position 35 and ends at position 160; the E-value for the Polysacc_synt_4 domain shown below is 3.2e-26.
IEMAWAIRAMQHAEVYYKLISSVDPQFLKLTKVDDQIYSEFREIFETLRVDVLDPEELKS ESAKEKWRPFCLKFEGIVEDYNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGY NKAVSV
Polysacc_synt_4 |
---|
PFAM accession number: | PF04669 |
---|---|
Interpro abstract (IPR021148): | This domain can be found in IRX15/IRX15L/IGXM from plants and in protein PBDC1 from animals and fungi. IRX15/IRX15L and IGXM play a role in xylan biosynthesis in plant cell walls. However, they have different functions [ (PUBMED:24576763) ]. The function of IRX15/IRX15L is not clear. GXM1/GXM2/GXM3 are methyltransferases catalysing 4-O-methylation of GlcA side chains on xylan [ (PUBMED:23045523) (PUBMED:24576763) ]. The function of PBDC1 (polysaccharide biosynthesis domain-containing protein) is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Polysacc_synt_4