The domain within your query sequence starts at position 313 and ends at position 409; the E-value for the Pox_MCEL domain shown below is 2.1e-20.
LIMAKKYNMKLIYKKTFLEFYEEKIKNNENKMLLKRMQALEQYPAHENSKLASEKVGDYT HAAEYLKKSQVRLPLGTLSKSEWEATSIYLVFAFEKQ
Pox_MCEL |
---|
PFAM accession number: | PF03291 |
---|---|
Interpro abstract (IPR004971): | This entry represents mRNA (guanine-N(7))-methyltransferase, which can either be found as a single domain protein, or as a domain within the mRNA-capping enzyme catalytic subunit. mRNA (guanine-N(7))-methyltransferase methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC [ (PUBMED:10679253) (PUBMED:7623811) (PUBMED:9790902) (PUBMED:9705270) (PUBMED:10347220) (PUBMED:22099306) ]. Viral mRNA capping enzymes, meanwhile, are multidomain proteins that catalyse the first two reactions in the mRNA cap formation pathway. They are heterodimers consisting of a large (catalytic) and small subunit. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pox_MCEL