The domain within your query sequence starts at position 206 and ends at position 249; the E-value for the Prenyltrans domain shown below is 2.8e-13.
INREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTN
Prenyltrans |
 |
|---|
| PFAM accession number: | PF00432 |
|---|---|
| Interpro abstract (IPR001330): | This repeat is found in a number of proteins, including prenyltransferase subunit beta and geranylgeranyl transferase subunit beta. |
| GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prenyltrans