The domain within your query sequence starts at position 1 and ends at position 82; the E-value for the Pro_dh domain shown below is 2.2e-15.
XRSYSRCLELMLRCVSNHGPPCHLMVASHNEESVRQATKRMWELGIPLDGPVCFGQLLGM CDHVSLALVHCSCLQILQKMAS
Pro_dh |
---|
PFAM accession number: | PF01619 |
---|---|
Interpro abstract (IPR002872): | The proline oxidase/dehydrogenase EC 1.5.99.8 is responsible for the first step in the conversion of proline to glutamate for use as a carbon and nitrogen source. The enzyme requires FAD as a cofactor, and is induced by proline. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pro_dh