The domain within your query sequence starts at position 61 and ends at position 165; the E-value for the Prothymosin domain shown below is 2.3e-26.
MLDADTSSKITTKVLKEKKEVVEEAENGRDVPANGNAQNKENGEQEADNEVDEEEEEGGE EEEEEEEEEGDDEEEDGDEDVEAEAPTGKQVAEDVDTKKKKTEKD
Prothymosin |
 |
|---|
| PFAM accession number: | PF03247 |
|---|---|
| Interpro abstract (IPR004931): | Prothymosin alpha and parathymosin are two ubiquitous small acidic nuclear proteins that are thought to be involved in cell cycle progression, proliferation, and cell differentiation [ (PUBMED:10854063) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prothymosin