The domain within your query sequence starts at position 337 and ends at position 465; the E-value for the Prp31_C domain shown below is 1.6e-48.
VKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSL GHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTP LQGLEIVNP
Prp31_C |
---|
PFAM accession number: | PF09785 |
---|---|
Interpro abstract (IPR019175): | This is the C-terminal domain of the pre-mRNA processing factor Prp31. Prp31 is required for U4/U6*U5 tri-snRNP formation [ (PUBMED:11867543) ]. In humans this protein has been linked to autosomal dominant retinitis pigmentosa [ (PUBMED:11867543) (PUBMED:12444105) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prp31_C