The domain within your query sequence starts at position 363 and ends at position 601; the E-value for the Pterin_bind domain shown below is 4.6e-63.
GERCNVAGSRKFAKLIMAGNYEEALSIAKAQVEMGAQVLDINMDDGMLDGPSAMTRFCNS IASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEGDFLEKARKIKKFGAA VVVMAFDEEGQATETDVKVNVCTRAYHLLVDKVGFNPNDIIFDPNILTIGTGMEEHNLYA INFIHATRVIKETLPGVRISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVN
Pterin_bind |
![]() |
---|
PFAM accession number: | PF00809 |
---|---|
Interpro abstract (IPR000489): | The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder. It has eight alpha-helices stacked around the outside of an inner cylinder of parallel beta-strands. The pterin ring binds at the bottom of the (beta/alpha;)8 barrel in a polar cup-like region that is relatively solvent exposed and fairly negatively charged. The pterin ring is partially buried within the (beta/alpha)8 barrel. The pterin binding residues are highly conserved and include aspartate and asparagine residues located at the C terminus of the beta-strands of the barrel, which are predicted to form hydrogen bonds with the nitrogen and oxygen atoms of the pterin ring [ (PUBMED:10997901) (PUBMED:9187658) (PUBMED:14752199) ]. Some proteins known to contain a pterin-binding domain are listed below:
|
GO process: | pteridine-containing compound metabolic process (GO:0042558) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pterin_bind