The domain within your query sequence starts at position 9 and ends at position 108; the E-value for the QIL1 domain shown below is 5.9e-29.
MRFLIKGSVAGGAVYLVYDQELLGPSDKSEAALRKAEEVVPPAMYQFSQYVCQQTGLEMP QLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAREYSK
QIL1 |
 |
|---|
| PFAM accession number: | PF15884 |
|---|---|
| Interpro abstract (IPR026769): | Mic13 (also known as Qil1) is a component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Mic13 is required for MICOS complex stability and cristae morphology [ (PUBMED:25997101) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry QIL1