The domain within your query sequence starts at position 235 and ends at position 303; the E-value for the RAI1 domain shown below is 2e-28.
VDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPHVVAGFR NPEGFVCSL
RAI1 |
![]() |
---|
PFAM accession number: | PF08652 |
---|---|
Interpro abstract (IPR013961): | Yeast RAI1 is homologous to Caenorhabditis elegans DOM-3 and human DOM3Z (DXO). They have both decapping and 5'-3' exoribonuclease activity and are a component of the mRNA 5'-end capping quality control mechanism [ (PUBMED:22961381) (PUBMED:26101253) ]. RAI1 is a single-copy gene in most organisms; however S. cerevisiae contains a second homologue, DXO1, which also possesses decapping and 5'-3' exoribonuclease activity, whereas RAI1 has decapping and pyrophosphohydrolase activities [ (PUBMED:22961381) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAI1