The domain within your query sequence starts at position 37 and ends at position 146; the E-value for the RAMP domain shown below is 1.1e-49.

QELCLSRFKENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAV
HHRYFSKCPISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEG

RAMP

RAMP
PFAM accession number:PF04901
Interpro abstract (IPR006985):

The calcitonin-receptor-like receptor can function as either a calcitonin-gene-related peptide or an adrenomedullin receptor. The receptors function is modified by receptor activity modifying protein (RAMP). RAMPs are single-transmembrane-domain proteins [ (PUBMED:9620797) ].

GO process:intracellular protein transport (GO:0006886), regulation of G protein-coupled receptor signaling pathway (GO:0008277)
GO component:integral component of membrane (GO:0016021)
GO function:coreceptor activity (GO:0015026)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAMP