The domain within your query sequence starts at position 1 and ends at position 63; the E-value for the RAMP4 domain shown below is 1.3e-39.

MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS
IRM

RAMP4

RAMP4
PFAM accession number:PF06624
Interpro abstract (IPR010580):

This entry contains Serp1/Serp2 and yeast Ysy6 stress-associated endoplasmic reticulum proteins. In humans, Serp1 (also known as RAMP4) interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It has also been shown to protect unfolded target proteins against degradation during ER stress. It may facilitate glycosylation of target proteins after termination of ER stress and may modulate the use of N-glycosylation sites on target proteins [ (PUBMED:10601334) (PUBMED:10469658) ].

GO component:endoplasmic reticulum (GO:0005783)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAMP4