SMART: Pfam domain RAWUL

The domain within your query sequence starts at position 234 and ends at position 330; the E-value for the RAWUL domain shown below is 1.3e-31.

PTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTI
YIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYA

RAWUL

PFAM accession number:	PF16207
Interpro abstract (IPR032443):	The RAWUL domain is found at the C terminus of poly-comb group RING finger proteins. It contains a variant ubiquitin-like fold with a distinct conserved surface region. The conserved surface found in this domain is responsible for interaction with Cbx members of the PRC1 (polycomb repression complex 1) and homodimer formation [ (PUBMED:19791798) ]. The RAWUL domain binds directly to PUFD, a domain on BCOR proteins (BCL6 corepressor). BCOR has emerged as an important player in development and health [ (PUBMED:23523425) ].

PFAM accession number:

PF16207

Interpro abstract (IPR032443):

The RAWUL domain is found at the C terminus of poly-comb group RING finger proteins. It contains a variant ubiquitin-like fold with a distinct conserved surface region. The conserved surface found in this domain is responsible for interaction with Cbx members of the PRC1 (polycomb repression complex 1) and homodimer formation [ (PUBMED:19791798) ].

The RAWUL domain binds directly to PUFD, a domain on BCOR proteins (BCL6 corepressor). BCOR has emerged as an important player in development and health [ (PUBMED:23523425) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAWUL