The domain within your query sequence starts at position 170 and ends at position 214; the E-value for the RBM1CTR domain shown below is 5.5e-26.
SSSGMGGRTPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTK
RBM1CTR |
![]() |
---|
PFAM accession number: | PF08081 |
---|---|
Interpro abstract (IPR012604): | This region is found in RBM1-like RNA binding hnRNPs [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RBM1CTR