SMART: Pfam domain RED

The domain within your query sequence starts at position 445 and ends at position 554; the E-value for the RED_C domain shown below is 1.1e-52.

YAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAF
QYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKR

RED_C

PFAM accession number:	PF07807
Interpro abstract (IPR012492):	This domain is found at the C terminus of Red protein ( Q13123 ). This and related proteins are thought to be localised to the nucleus, and contain a RED repeat which consists of a number of RE and RD sequence elements [ (PUBMED:10216252) ]. The function of Red protein is unknown, but efficient sequestration to nuclear bodies suggests that its expression may be tightly regulated or that the protein self-aggregates extremely efficiently [ (PUBMED:10216252) ].

PFAM accession number:

PF07807

Interpro abstract (IPR012492):

This domain is found at the C terminus of Red protein ( Q13123 ). This and related proteins are thought to be localised to the nucleus, and contain a RED repeat which consists of a number of RE and RD sequence elements [ (PUBMED:10216252) ]. The function of Red protein is unknown, but efficient sequestration to nuclear bodies suggests that its expression may be tightly regulated or that the protein self-aggregates extremely efficiently [ (PUBMED:10216252) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RED_C