The domain within your query sequence starts at position 1127 and ends at position 1248; the E-value for the REV1_C domain shown below is 1.2e-43.
EEVSASTPGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDIL QVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTL KV
REV1_C |
![]() |
---|
PFAM accession number: | PF16727 |
---|---|
Interpro abstract (IPR031991): | This entry represents the C-terminal domain of DNA repair protein Rev1. This domain adopts a four-helix bundle that interacts with Rev7, Polkappa and Poleta. However, the Rev7-binding interface is distinct from the binding site of DNA polymerase eta or kappa [ (PUBMED:22859296) (PUBMED:23143872) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry REV1_C