The domain within your query sequence starts at position 2 and ends at position 137; the E-value for the RFC1 domain shown below is 1.7e-46.

FLSSQAIYASVLPGELMRGYMTQFPSFPSWLGKHSSTGKHDRIVQDLSLHMSLRTYSSKR
TVNMDYLSHIRDALVRPLTSQGVEGAQHVIKLMDTYYLMKEDFENIMEVSSWGGKPSAFS
KLDPKVKAAFTRAYNK

RFC1

 RFC1
PFAM accession number:PF08519
Interpro abstract (IPR013725):

This is the C-terminal domain of replication factor C, RFC1. RFC complexes hydrolyse ATP and load sliding clamps such as PCNA (proliferating cell nuclear antigen) onto double-stranded DNA. RFC1 is essential for RFC function in vivo [ (PUBMED:16040599) (PUBMED:9092549) ].

GO process:DNA replication (GO:0006260)
GO component:DNA replication factor C complex (GO:0005663)
GO function:ATP binding (GO:0005524), DNA clamp loader activity (GO:0003689)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFC1