The domain within your query sequence starts at position 899 and ends at position 1052; the E-value for the RFC1 domain shown below is 2.5e-61.
ICDGDLVDNQIRSKQNWSLLPTQAIYASVLPGELMRGYMTQFPSFPSWLGKHSSTGKHDR IVQDLSLHMSLRTYSSKRTVNMDYLSHIRDALVRPLTSQGVEGAQHVIKLMDTYYLMKED FENIMEVSSWGGKPSAFSKLDPKVKAAFTRAYNK
RFC1 |
---|
PFAM accession number: | PF08519 |
---|---|
Interpro abstract (IPR013725): | This is the C-terminal domain of replication factor C, RFC1. RFC complexes hydrolyse ATP and load sliding clamps such as PCNA (proliferating cell nuclear antigen) onto double-stranded DNA. RFC1 is essential for RFC function in vivo [ (PUBMED:16040599) (PUBMED:9092549) ]. |
GO process: | DNA replication (GO:0006260) |
GO component: | DNA replication factor C complex (GO:0005663) |
GO function: | DNA clamp loader activity (GO:0003689), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFC1