The domain within your query sequence starts at position 4 and ends at position 149; the E-value for the RFX1_trans_act domain shown below is 1.9e-50.
SEGGADSPASVALRPAAQPMPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQHVY PAQVQYVEGGDAVYANGAIRAAYAYNPDPQLYAPSSAASYFETPGGTQVTVAASSPPAVP SHGMVGITMDVSGTPIVSGAGAYLIH
RFX1_trans_act |
![]() |
---|
PFAM accession number: | PF04589 |
---|---|
Interpro abstract (IPR007668): | The RFX family is a family of winged-helix DNA-binding proteins. RFX1 is a regulatory factor essential for expression of MHC class II genes. This region is found N-terminal to the RFX DNA-binding region ( IPR003150 ) in some mammalian RFX proteins, and is thought to activate transcription when associated with DNA. Deletion analysis has identified the region 233-351 in human RFX1 ( P22670 ) as being required for maximal activation [ (PUBMED:9278482) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFX1_trans_act