The domain within your query sequence starts at position 521 and ends at position 603; the E-value for the RFX_DNA_binding domain shown below is 1.7e-26.
EKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTV KRVEDSTSSGQAHIHVIGVKRRA
RFX_DNA_binding |
 |
|---|
| PFAM accession number: | PF02257 |
|---|---|
| Interpro abstract (IPR003150): | The RFX family of transcription factors is characterised by a unique approximately 75-residue DNA-binding domain. RFX genes have been isolated in yeasts, nematode and vertebrates. The characteristic RFX-type HTH DNA binding domain has been recruited into otherwise very divergent regulatory factors functioning in a diverse spectrum of unrelated systems, including regulation of the mitotic cell cycle in fission yeast, the control of the immune response in mammals,and infection by human hepatitis B virus [ (PUBMED:8600444) (PUBMED:10767550) ]. The RFX-type DNA-binding domain is an unusual member of the winged-helix subfamily of helix-turn-helix domains because it uses a beta-hairpin (or wing) to recognise DNA instead of the recognition helix typical of helix-tun-helix domains. It consists of three alpha-helices (H), three beta-strands (S) and three connecting loops (L), arranged in the order H1-S1-H2-L1-H3-L2-S2-W1-S3. The third loop, connecting beta-strands S2 and S3, forms wing W1 of the winged-helix motif. In contrast to previously described winged-helix DBDs (typically 110 residues long with two wings, W1 and W2), the shorter RFX-type winged-helix DNA-binding domain has only one wing [ (PUBMED:10706293) ]. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
| GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFX_DNA_binding