The domain within your query sequence starts at position 1 and ends at position 137; the E-value for the RGCC domain shown below is 7.3e-70.
MKPPSAQSSPAAVAAAAPAMDSAAAADLTDVLCEFDAVLADFASPFHERHFHYEEHLERM KRRSSASVSDSSGFSDSESADSVYRDSFTFSDEKLNSPTNSSPALLPSAVTPRKAKLGDT KELEDFIADLDRTLASM
RGCC |
---|
PFAM accession number: | PF15151 |
---|---|
Interpro abstract (IPR029252): | RGCC (also known as RGC32) modulates the activity of cell cycle-specific kinases and may play a role in cell cycle activation [ (PUBMED:17146433) (PUBMED:9756947) ]. This family of proteins is found in eukaryotes and has a conserved KLGDT sequence motif. |
GO process: | regulation of cell cycle (GO:0051726) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RGCC