The domain within your query sequence starts at position 2327 and ends at position 2380; the E-value for the RHS_repeat domain shown below is 5.5e-7.
YNSAGLLIKAYNRASGWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVT
RHS_repeat |
![]() |
---|
PFAM accession number: | PF05593 |
---|---|
Interpro abstract (IPR031325): | RHS (rearrangement hotspot) proteins contain extended repeat regions. These repeats often appear to be involved in ligand binding [ (PUBMED:10341219) ]. Note that the signature in this entry does not find all the repeats in a protein and that it covers two RHS repeats. The 3D structure of an RHS-repeat-containing protein (the B and C components of an ABC toxin complex) has been determined. The RHS repeats form an extended strip of beta-sheet that spirals around to form a hollow shell, encapsulating the variable C-terminal domain [ (PUBMED:23913273) ]. The RHS repeat shares structural similarity with the eukaryotic tyrosine-aspartate (YD)-repeat [ (PUBMED:23913273) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RHS_repeat