SMART: Pfam domain RIB43A

The domain within your query sequence starts at position 4 and ends at position 379; the E-value for the RIB43A domain shown below is 1.6e-135.

LDLVSDPRELAAIEARRNREKERQSRFFNVRNRVMGVDVEALNYQVEERKFREAIERNKD
IAYGTKHAHYDLVAQMLEKEEAERAYRLSKRVQDFREQRQQQYKNGHEFDFWDPDQFQEF
RVPYYEKDAYFGPASMQYFFGEDLERASHVRMQQEQMRYNLEKQLQEQQAAREEEARAAL
LSDQLRLAADTRAAELARLEESCRAAMRTAMANANKAQAAKQALQQRREQQRQQEANLTE
VKKQVTSDLLTENPQVAQRANAPHRVLPYCWKGMSAEQRAAIRKTQETQRQEKKEQRQAE
KLVEAEWGRQNKRLAEAALELEEQERELCAEFRRGLGSFNRELAKEQQAQQNYLNSVIYT
NQPTAHYYLQFNTSSR

RIB43A

PFAM accession number:	PF05914
Interpro abstract (IPR008805):	This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [ (PUBMED:10637302) ].

PFAM accession number:

PF05914

Interpro abstract (IPR008805):

This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [ (PUBMED:10637302) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RIB43A