The domain within your query sequence starts at position 3878 and ends at position 3996; the E-value for the RIH_assoc domain shown below is 6.2e-35.
MADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFY WYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFL
RIH_assoc |
---|
PFAM accession number: | PF08454 |
---|---|
Interpro abstract (IPR013662): | This eukaryotic domain is found in ryanodine receptors (RyR) and inositol 1, 4, 5-trisphosphate receptors (IP3R) which together form a superfamily of homotetrameric ligand-gated intracellular Ca2+ channels [ (PUBMED:14516409) ]. There seems to be no known function for this domain [ (PUBMED:10664581) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RIH_assoc