The domain within your query sequence starts at position 123 and ends at position 180; the E-value for the RILP domain shown below is 3.4e-25.

TLQELREVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAVVAMGNGEKE

RILP

• PFAM accession number: PF11461
• Interpro abstract (IPR021563):

  Rab interacting lysosomal protein (RILP) contains a domain which contains two coiled-coil regions and is found mainly in the cytosol. RILP is recruited onto late endosomal and lysosomal membranes by Rab7 and acts as a downstream effector of Rab7 [ (PUBMED:15933719) ]. This recruitment process is important for phagosome maturation and fusion with late endosomes and lysosomes.

• GO function: protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RILP