The domain within your query sequence starts at position 430 and ends at position 508; the E-value for the RNA_bind domain shown below is 2.2e-37.
GPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVN TSKYAESYRIQTYAEYVGK
RNA_bind |
![]() |
---|
PFAM accession number: | PF08675 |
---|---|
Interpro abstract (IPR014789): | This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN). PARN is a 3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails [ (PUBMED:9736620) ]. |
GO process: | mRNA catabolic process (GO:0006402) |
GO component: | cytoplasm (GO:0005737), nucleus (GO:0005634) |
GO function: | RNA binding (GO:0003723), metal ion binding (GO:0046872), poly(A)-specific ribonuclease activity (GO:0004535) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_bind