The domain within your query sequence starts at position 430 and ends at position 508; the E-value for the RNA_bind domain shown below is 2.2e-37.

GPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVN
TSKYAESYRIQTYAEYVGK

RNA_bind

RNA_bind
PFAM accession number:PF08675
Interpro abstract (IPR014789):

This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN). PARN is a 3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails [ (PUBMED:9736620) ].

GO process:mRNA catabolic process (GO:0006402)
GO component:cytoplasm (GO:0005737), nucleus (GO:0005634)
GO function:metal ion binding (GO:0046872), poly(A)-specific ribonuclease activity (GO:0004535), RNA binding (GO:0003723)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_bind