The domain within your query sequence starts at position 716 and ends at position 823; the E-value for the RNA_pol_Rpb1_4 domain shown below is 3.6e-39.
VIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAK GSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFV
RNA_pol_Rpb1_4 |
![]() |
---|
PFAM accession number: | PF05000 |
---|---|
Interpro abstract (IPR007083): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This entry, domain 4, represents the funnel domain. The funnel domain contains the binding site for some elongation factors [ (PUBMED:8910400) (PUBMED:11313498) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb1_4