The domain within your query sequence starts at position 846 and ends at position 958; the E-value for the RNA_pol_Rpb1_4 domain shown below is 1.3e-26.

CDEIQGKWQDAHLSKDQRDFNMIDMKFKEEVNHYSNEINKACMPLGLHRQFPENNLQMMV
QSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFV

RNA_pol_Rpb1_4

RNA_pol_Rpb1_4
PFAM accession number:PF05000
Interpro abstract (IPR007083):

RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This entry, domain 4, represents the funnel domain. The funnel domain contains the binding site for some elongation factors [ (PUBMED:8910400) (PUBMED:11313498) ].

GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb1_4