The domain within your query sequence starts at position 896 and ends at position 1079; the E-value for the RNA_pol_Rpb1_6 domain shown below is 1.7e-70.

LAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELERE
FERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKE
LSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESK
FNQA

RNA_pol_Rpb1_6

• PFAM accession number: PF04992
• Interpro abstract (IPR007075):

  RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain, domain 6, represents a mobile module of the RNA polymerase. Domain 6 forms part of the shelf module [ (PUBMED:8910400) (PUBMED:11313498) ]. This family appears to be specific to the largest subunit of RNA polymerase II.

• GO process: transcription, DNA-templated (GO:0006351)
• GO function: DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb1_6