The domain within your query sequence starts at position 438 and ends at position 502; the E-value for the RNA_pol_Rpb2_3 domain shown below is 2.6e-22.
QVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLA LMTHI
RNA_pol_Rpb2_3 |
![]() |
---|
PFAM accession number: | PF04565 |
---|---|
Interpro abstract (IPR007645): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 3, is also known as the fork domain and is proximal to catalytic site [ (PUBMED:11313498) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_3